Skip to main content

Home/ Diigo Community/ Group items tagged local Listing

Rss Feed Group items tagged

Filter: All | Bookmarks | Topics Simple Middle
Antony Earthling

Is it possible for the Chrome extension to create a local bookmark like the firefox and... - 31 views

I find in general that there are too many inconsistencies between the Chrome extension and IE/FF toolbars.

chrome

started by Jeremy Gollehon on 28 Oct 10 4 follow-ups, last by Antony Earthling on 11 Nov 10
Yoni Blumberg

Export cache - 290 views

Seems that it is planned. Sorry for not doing my research: http://feedback.diigo.com/forums/76211-ideas/suggestions/1170543-offer-an-export-feature-that-includes-images-and-c

export feature suggestion

started by slinkygn on 09 Dec 07 30 follow-ups, last by Yoni Blumberg on 08 Mar 11
appkodes s

Ten Conventional Advertising Methods That Will Jeopardize Airbnb Clone Script - 2 views

    Many airbnb clone script realtors, like most companies, continue to market their businesses the same way that they have been for a long time. Possibly worse, many Realtors just market...

airbnbclonescript

started by appkodes s on 09 Feb 17 no follow-up yet
The Ravine / Joseph Dunphy

How to become more visible on Diigo? - 19 views

Mr. Rhay, My experience with Diigo is very limited, but having moderated and participated in groups elsewhere, I have found one thing to be true: activity attracts activity, and inactivity pre...

diigo socialbookmarking profile friend bookmark groups lists post

started by Danny Rhay on 17 Aug 09 2 follow-ups, last by The Ravine / Joseph Dunphy on 16 Sep 09
iplnts

How many characters are allowed in the tag list? - 42 views

Hi Maggie! You are absolutely right. I was redundant. It really unneccessarily increases the space. I will be attentive to this in the future! Thanks for drawing to my attention! maggie_diigo ...

feature tag

started by iplnts on 13 May 07 4 follow-ups, last by iplnts on 14 May 07
webtrafficagency

Why you should list your business on Google My Business - 0 views

webtrafficdigitalmarketingagency.weebly.com/...find-your-business-on-google

Webtraffic.agency Local SEO

shared by webtrafficagency on 02 Oct 17 - No Cached
  • webtrafficagency on 02 Oct 17
     
    Google My Business - It is the thing where we can use the local SEO to find the business and to get the keywords for the area wise location
realserviceit654

Buy Elite Yelp Reviews - 100% Non-Drop,Safe, Permanent, Cheap ... - 0 views

realserviceit.com/...buy-elite-yelp-reviews

brainstorm help resolved group tag dictionary syntax WebKit Windows XP Firefox Intel PowerPC 3.1b506 3.1.6.13 3.1.6.12 suggestion 3.1.6.11 load performance Mozilla 3.1.6.7 inconsistency 3.1.5.7 educator compatibility toolbar bug Internet Explorer Mac OS X

shared by realserviceit654 on 26 Dec 23 - No Cached
  • realserviceit654 on 26 Dec 23
     
    What You Need to Know About Elite Yelp Reviews The first thing you need to know about Elite Yelp Reviews is that they are not the same as regular reviews. In fact, they can be even better! Elite reviews have a higher quality rating than regular ones do and are written by users who have received extensive training on how to write effective customer testimonials. This means that your business will be able to get more clients who trust what they read in these reviews and feel confident buying from you because of them. Buy Elite Yelp Reviews One thing that I love about having elite Yelp reviews is how easy it was for me just by paying $99 per month (which includes unlimited access) until my account was closed down due to lack of funds six months later." How to Buy Elite Reviews on Yelp How to Buy Elite Reviews on Yelp Yelp is the world's largest local search and discovery engine. They have more than 1 million reviews from their users, which makes it a great place to get professional Elite Reviews for your business. If you're looking for ways to increase your visibility on Yelp and make sure that people are talking about your business, then this guide will show you how! Buy Elite Yelp Reviews How To Get Professional Elite Reviews From Your Business: The Truth About Having Elite Reviews On Yelp & Why It Matters How to Get Professional Elite Reviews From Your Business If you're looking to improve your business, then Elite Yelp Reviews is a great place to start. It's important that you have a good service and product before trying to get professional reviews on Yelp. The best way to do this is by offering a good price and being honest and transparent with your customers about what they will receive in return for their money. If you want more tips on how to get elite reviews from yelp or other platforms, visit our website here: https://www.elitereviewsnowyplatypus.com/ The Truth About Having Elite Reviews on Yelp When you see the word "Elite" next to a busin
tech vedic

Recycle your old tech gear - 0 views

www.facebook.com/photo.php

shared by tech vedic on 22 May 13 - No Cached
  • tech vedic on 22 May 13
     
    In springtime, people's fancies may turn to love, but their to-do list turns to cleaning. Make this the year that you finally recycle all the ancient MP3 players, toner cartridges, ethernet cables, and bulky monitors out of the closets, garages, and spare rooms where they've been lurking. Your home will feel more modern, and you'll be doing your part to boost the 27 percent electronics recycling rate. Just in time for another spring constant, Earth Day. Before you get rid of any of your electronics The first step on your recycling journey: Make sure that none of your personal data will be leaving the house along with your soon-to-be-discarded electronics. If you're using Apple's iTunes to manage your digital music and video, be sure you deauthorize any device you're recycling. "But that computer is dead" is no excuse: Apple expects you to simply deauthorize all your devices via the iTunes app, then reauthorize the ones that are still alive If you're recycling a smartphone, do a complete reset of your phone to wipe out its data and restore it to its factory settings. Before you do this, however, make sure that you've got your data backed up someplace else If you're recycling a computer or a hard drive, don't just assume that deleting files will wipe the data off your system, because it won't. All it does is reformat the space on the drive, and the data can be snagged using tools designed for disaster recovery. Now, on to recycling Broadly speaking, you have three recycling options: You can drop off your unwanted stuff in person somewhere; you can ship it away; or you can donate it to a willing organization. Drop it off in person. The advantage to dropping off your gear is that you don't need to really plan ahead and print out prepaid labels (as you would if you were shipping things away); you just toss your stuff in the car and go Another option that's cropping up across the U.S. is the electronics recyc
Maggie Tsai

JimStroud 2.0 - SOURCING TIP: And Diigo was its name-O - BlogCharm - 2 views

www.blogcharm.com/...+And+Diigo+was+its+name-O.html

diigo review

shared by Maggie Tsai on 08 Feb 07 - Cached
jincheng li liked it
  • SOURCING TIP: And Diigo was its name-O One thing I have been ranting about (online and offline) is the need for a tool that will allow researchers to seemlessly share their intelligence. Imagine (as I often have) the time that would be saved if I were to discover a resume online and then see a note left by one of my co-workers that reads, "Been here, done that and submitted the candidate." Wowzers! That would really cut-down on duplication of efforts wouldn't it?
  • Okay, so let me show you something  I really like and am recommending that research teams use - Diigo. This FREE product has enough features that I would willingly pay for it and from me, that is a high compliment. Here are a few highlights from the VERY LONG list of features they offer. (Man, these guy are good!) A few highlights from their website... The Best Web Annotation Service: Add highlights and sticky notes on any web page, anywhere, and access them anywhere. A Great Webpage Clipping Tool: Highlighted portions of any webpage are clipped and collected centrally, which can be shared and searched. An All-in-One Bookmarking Tool: Bookmark webpages to Diigo, local folder, del.icio.us , Simpy, Furl, Spurl... and make them permanently cached and full-text searchable. A Great Collaborative Platform: Share and interact on online findings, complete with highlights and sticky notes. The Most Customizable Search Tool: Like Google's toolbar, but far more customizable, so you can access any search service with one-click --- music, maps, references, local library, New York Times, ... Unique Content Selection Menu: Interact with any word on a webpage just by selecting it, no click needed! - highlight, search, look up - whatever you you want!
  • With a virtual highlighter and digital sticky notes, now you can highlight & jot down your comments directly on any part of a webpage and scan through all your research findings quickly. Keep your annotations private or share with others. Exchange viewpoints on any specific area of a webpage - great for collaboration or debating an issue. Tags and full-text search on everything make it extremely easy to organize and find stuff - no need to fumble with folders and subfolders. You control the privacy setting on what can be seen by public or kept private. Need someone to pay special attention to a particular section of a webpage? You can forward a webpage with your highlights & Sticky notes. For further interactions, your friends can append their comments under your notes right on the page.Discover relevant / new content based on specific users, topics of interest, recommendations, hot lists, and more. For example, to discover high quality contents on some subject, check out bookmarks under specific tags - remember these represent the joint effort of lots of people.   ** Now here is something that I think is a killer feature! I download the Diigo toolbar and when I come to a page that has been annotated, I am notified (see arrow). I can set this to show me only the notes I have left behind or, the public notes of others. And get this, once I set up my free web-based account, I share that info (my log-in) with my co-workers and all of the annotations we mark private are only seen by us. (Wink) Ahhh... now this is a tool worth noting, using and (above all else) sharing with other researchers on your team. (Click here for virtual tour of their product.) 4-Star recommendation!!!
  • anonymous on 17 Sep 13
     
    Hallo guys. I am very happy to share here. This is my site. If you would like to visit here. Go ahead. I've made ​​About a $ 58,000 from my little site. There is a forum and I was very happy to announce to you. I also provide seo service. www.killdo.de.gg
  • anonymous on 25 Sep 13
     
    You can making over $59.000 in 1 day. Look this www.killdo.de.gg
buyingagents

Important Points to Consider Before Starting to Import. - 0 views

www.mavensplanet.com/ider-before-starting-to-import

Import agents

shared by buyingagents on 26 Aug 14 - No Cached
  • buyingagents on 26 Aug 14
     
    1) Determine if there is a local market for the goods that you intend to introduce It is important for you to make sure that there is a reliable market demand for the goods that you intend to procure from outside the country. This will help shield you from any unnecessary losses. It can be hard on you and your business to find that all the time, effort and money expended in importing a consignment of goods is bound to be wasted due to lack of demand for the end products that will be manufactured. Forming focus groups that will research and find out if the market is interested in what you have to offer will help you know how much inventory you will allow the business to keep in its stores. It will also enable you to know how much money you want to spend on purchasing goods outside the country. 2) Find out if you are legally allowed to import the items you have purchased It will help if you have a legal compliance department in your business. If you cannot afford to run one, then you should have a lawyer working with you. Choose one that is an expert in international law and laws pertaining to the customs departments. This is the person who will tell you whether the items being imported are legally allowed in the country or not. Failure to get legal representation could end up in you importing contraband such as arms, ivory tusks and so on. By having good legal representation before making the import, your business will have saved face. 3) Estimate the costs of importing the goods in question Before placing an order with a company outside your country's borders, it would be prudent to list down all the costs associated with the whole exercise. Some of these costs might include: 1) The cost of storing the goods before they reach your warehouse 2) Duties and taxes that have to be paid at customs checkpoints 3) Charges for using brokers and freighters at ports, harbors and border checkpoints.
narola

Digital Marketing Agency | Narola Internet Marketing Services - 0 views

www.narolainfotech.com/digital-marketing

seo ppc seoservices enterprise aso smm socialmedia digitalmarketing

shared by narola on 23 Aug 18 - No Cached
  • narola on 23 Aug 18
     
    Narola is one of the Renowned digital marketing company offering services like Local SEO, Pay Per Click, Social Media Management, and App Store Optimization. Contact us to get your site listed in serps.
callnall

https://www.callnall.com/list/noida/travel/packer-and-movers/ - 0 views

www.callnall.com/...packer-and-movers

Movers Packers

shared by callnall on 24 Jun 22 - No Cached
  • callnall on 24 Jun 22
     
    Local & Domestic Moving, Residential & Office Shifting, Hassle-Free Service Get Best Quote. CallNAll Packers & Movers Provides You with 100% Safest and Fastest Relocation Service.
Joel Liu

Expand no. of the character input in tagging & support Chinese text searching - 73 views

>in my bookmark collection, it not only excludes all my Chinese tags due to "Tag number", but also cut >half of one tag "safety" to "saf". It could because a break-down of the whole tagging system....

performance locale tag index import count limit resolved spam (electronic)

started by Alan Poon on 21 Mar 08 9 follow-ups, last by Joel Liu on 05 Apr 08
Graham Perrin

Notes in Lists? Local Bookmark folders on the Quick Access Option? - 23 views

Whats going on? did a whole bunch of features suddenly happen? What are these mysterious "notes" in the Lists sections?

help notes lists Quick Access

started by Suzannah Claire on 08 Nov 09 1 follow-up, last by Graham Perrin on 13 Nov 09
seocbe123

Call taxi services in Coimbatore, Cabs Booking, Rentals - 0 views

www.123coimbatore.com/call-taxi-in-coimbatore

taxi in coimbatore numbers prices top best car rentals services packages details contact local airport kovai cheapest call list cabs outstation

shared by seocbe123 on 16 Oct 19 - No Cached
  • seocbe123 on 16 Oct 19
     
    Enjoy your interesting journey by finding the safest call taxi services, number, rentals in Coimbatore offered by the list of Taxies in our site and its detailed information
Graham Perrin

would be helpful to see the domain ('more from ...') in Groups - 35 views

… domain ('more from ...') in Groups Diigo Meta in Diigo 4.0 beta leads to the site community for the bookmarked page, so for example http://www.diigo.com/bookmark/http://www.hefce.ac.uk...

domain_name groups domain site community context meta suggestion

started by davido T on 19 Oct 07 4 follow-ups, last by Graham Perrin on 11 Oct 09
Graham Perrin liked it
hu xiaotao

Wondershare AllMyTube for Mac Coupon Code - 2 views

Wondershare AllMyTube for Mac can automatically detect online video files from the websites you have opened with Safari. It is an absolutely free YouTube video downloader for Mac, and set convert Y...

started by hu xiaotao on 11 Jul 13 no follow-up yet
sandy_diigo

Diigo 5.1.0.32 causing ie9 to crash - 43 views

The IE platform is not very friendly for developers. It is hard for us to debug the problem. We have added it to our to-do list with lower priority. Since engineers are very busy with rolling out n...

5.1.0.32 toolbar ie9 crash

started by Norm Sash on 22 Feb 12 5 follow-ups, last by sandy_diigo on 27 Feb 12
Maggie Tsai

web 2.0 blog » Beta Review - diigo social bookmarking and annotation service - 0 views

web2.0-blog.com/...marking-and-annotation-service

diigo links review

shared by Maggie Tsai on 08 Feb 07 - Cached
  • A few weeks back I managed to score an invite to a new social bookmarking/annontation site called diigo. I am quite excited by the potential of a service such as this and its really starting to realise some of the oppourtunity out there. Essentially diigo lets you bookmark pages, tag those bookmarks, add comments to those bookmarks, highlight content within pages, add comments to those pages that are viewable by all diigo users and utilise all the community features your used to like subscribing to your friends lists. Thats not a list of features that springs out of the page, many of these ideas have been attempted previously. Its more the deftness that diigo handles these ideas with that makes it stand out from the pack. Theres also the fact that its all bundled into one service.
  • the best way to sum up a service like diigo is that it overlays a Web 2.0 service on top of Web 1 sites. Things like tagging, annotation, social bookmarking and social commenting are very Web 2.0 in nature. diigo allows you to apply these ideas to normal Web 1 style sites.
  • Take, for example the BBC News site. Theres an awfull lot of content on there, some of which I would be interested in the thoughts of others on. Currently only certain, carefully chosen stories feature comments. diigo, however, allows you to comment on these stories, furthermore you can highlight actual pieces of text within the story and comment on them. And then others can view your comments and add their own. It is possible to have a linear conversation based around single web pages or even paragraphs of content. When you take the potential of the above and add in a competant social bookmarking service you can begin to see where diigo is heading as a service. The diigo team are aware that there are numerous other services out there, the one that is certainly a huge obstacle in terms of social bookmarking is del.icio.us, a service that I absolutely love. To make the transition a bit easier you can import your bookmarks into diigo from del.icio.us, you can also automatically add your diigo bookmarks to del.icio.us
  • ...3 more annotations...
  • One of the things I’ve seen other people rave about is the ability to have “private” objects on diigo. So an annotation, bookmark, comment etc can be hidden from other users, something that can only currently be done in del.icio.us with a hack. Personally I think this is neither here nor there, while its nice to have the option (when I first started using del.icio.us I did feel I was being forced into the whole social aspect of it rather than finding my own way) it does remove from some of the community aspects. Of course this is an obvious attempt to move diigo into local (browser) bookmark territory as opposed to what del.icio.us is usually used for, which tends to be more for points of interest. There are sites I have bookmarked, such as my bank, that I would never add to del.icio.us, I would be more tempted to add it as a private bookmark to diigo (although I haven’t).
  • The bookmarklet is in fact very advanced, you fire it up and a small toolbar appears at the top of your browser window. One option allows you to bookmark the page and there are links to your diigo bookmarks and subscriptions. Theres also a “highlight” option that only becomes active when you have some text highlighted. Generally the bookmarklet works well, you can hide it from your screen and call it back by moving your mouse to the left of the browser and it generally copes well.
  • To sum up, I liked the diigo service. Its attempt to augment basic webpages with advanced features is admirable. Currently theres a sense of community lacking which may be down to the fact that it is currently a closed beta, it may also be down to the lack of a “popular” page be it overall or by tag, both would be good. There are also a lot of features that are in the pipeline and alot of features that I didn’t get a chance to test out, features like “Blog This”
  • anonymous on 25 Sep 13
     
    You can making over $59.000 in 1 day. Look this www.killdo.de.gg
‹ Previous 21 - 40 of 66 Next › Last »
Showing 20▼ items per page